Antibodies
Rabbit polyclonal antibody to CSF1 | |
---|---|
![]() |
![]() |
Formulation | Lyophilized powder |
Purification | Affinity purified |
Host Species | Rabbit |
Unit Size: | 50 µg |
Immunogen | Synthetic peptide |
Sequence: | MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP |
Alternative Names | Lanimostim, Macrophage Colony-Stimulating Factor 1 |
Accession Number: | P09603 |
Gene Symbol | CSF1 |
Accession URL: | http://www.uniprot.org/uniprot/P09603 |
Function: CSF1 is a cytokine that controls the production, differentiation, and function of monocytes/macrophages. CSF1 increases susceptibility of macrophages to viral infection, and enhances HIV)replication in infected macrophages. Nuclear NFAT can activate CSF-1 gene transcription by connecting with the CSF-1 promoter in the signaling events induced by L-selectin ligation. |
|
Applications: | Immunohistochemistry (IHC), Immunocytochemistry (ICC), Western Blotting (WB). |
Working Dilution for Immunofluorescence (ICC): | 2 – 15 µg/mL |
Working Dilution for Immunohistochemistry (IHC): | 1 – 10 µg/mL |
Working Dilution for Western Blottin (WB): | 1 µg/mL |
IHC Positive control: | stromal cell in placenta |
Specificity: | Confirmed by WB. |
Reactivity: | Human |
Reconstitution: | Reconstitute in 0.05 mL of PBS (pH 7.4) to achieve an antibody concentration of 1000 µg/mL. Centrifuge to remove any insoluble material. |
Storage / Stability: | At least 12 months after purchase at 2 - 4°C. After reconstitution, aliquot and store at -20°C for a higher stability and at 4°C with an appropriate antibacterial agent. Avoid freeze-thaw cycles. |
References
|